PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35397_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25424.3 Da    PI: 9.8661
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35397_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF663.9e-211053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    + en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  Neem_35397_f_1 10 KLENTNGRQATYAKRKHGIMKKANELSILCDIDIILLMFSPTGK 53
                    6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.563153IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-28160IPR002100Transcription factor, MADS-box
CDDcd002664.05E-24282No hitNo description
SuperFamilySSF554555.36E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YAKRKHGIMK KANELSILCD IDIILLMFSP TGKPSLCNGK  60
RSSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNVQEFLGTS SQTIEGFLIS  120
SRGTEIQSMQ CYWTNPDKIN SVEHLGQMEN SLREYLNQIR VHKENLGKQQ LMSLECSSQF  180
QHGMHIPFRL GSEQQLQPLS WIPSNDNRPL VLPEDPNLLS HR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-13192190Myocyte-specific enhancer factor 2B
1tqe_Q7e-13192190Myocyte-specific enhancer factor 2B
1tqe_R7e-13192190Myocyte-specific enhancer factor 2B
1tqe_S7e-13192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438714.11e-135hypothetical protein CICLE_v10031963mg
RefseqXP_006483134.11e-135PREDICTED: agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA48e-89AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A067GTB41e-135A0A067GTB4_CITSI; Uncharacterized protein
TrEMBLV4VH981e-135V4VH98_9R
STRINGPOPTR_0008s08780.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.29e-79AGAMOUS-like 30